PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G215800.1
Common NamePHAVU_007G215800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 345aa    MW: 38752.1 Da    PI: 4.8988
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G215800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +grWT+eEd++l+++++  G g+W++ ++  g+ R++k+c++rw +yl
  Phvul.007G215800.1 14 KGRWTAEEDQILAKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

2Myb_DNA-binding537.7e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+ ++eE+  +v++++ lG++ W++Ia++++ gRt++++k++w+++l
  Phvul.007G215800.1  67 RGNISAEEENTIVKLHASLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                         7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.896961IPR017930Myb domain
SuperFamilySSF466899.17E-2811108IPR009057Homeodomain-like
SMARTSM007177.6E-121363IPR001005SANT/Myb domain
PfamPF002497.0E-151461IPR001005SANT/Myb domain
CDDcd001677.36E-81661No hitNo description
PROSITE profilePS5129425.55562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.5E-1666114IPR001005SANT/Myb domain
PfamPF002494.6E-1567112IPR001005SANT/Myb domain
CDDcd001673.94E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRAPCCQKV GLKKGRWTAE EDQILAKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI SAEEENTIVK LHASLGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIYSFP  120
RMEKQQGAGA LDPPKVVCIP PKRKGGRTSR WAMQKNKNYT QNSDKPKHSF SEQNSSDSRV  180
PKAAESEGLL NGVREWKAAE VDEKCEKEKS GGGEVVEVCE FEGIDEGSGA LGISEMLESY  240
LAETCGVWDI SEERESNDAE VVGVADACPS KTRSFDSSVN KLWDWESVIE FDNISESQLI  300
SEHSDEKDKF LTWLWEDDDW ESDGNKLGET DSQIQNEVVD WLLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-23121162105MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-23121162105C-Myb DNA-Binding Domain
1mse_C1e-23121162105C-Myb DNA-Binding Domain
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145164.10.0hypothetical protein PHAVU_007G215800g
TrEMBLV7BJF50.0V7BJF5_PHAVU; Uncharacterized protein
STRINGGLYMA02G01740.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.16e-76myb domain protein 12